PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2DL_912473A86.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 303aa    MW: 33584.7 Da    PI: 6.5095
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2DL_912473A86.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.48.7e-10141646
                           HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding  6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                           +eEd  l++ v+ +G+++W++I ++  + Rt+k+c++rw +
  Traes_2DL_912473A86.1  1 AEEDSVLLEHVRTHGPRDWSSIRSKGALQRTGKSCRLRWVN 41
                           59********************998889***********87 PP

2Myb_DNA-binding41.62.9e-135292345
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                           +++++E+   +++ +q+G++ W++Ia +++ gRt++++k++w 
  Traes_2DL_912473A86.1 52 KFSADEERVVIELQAQFGNK-WARIATYLP-GRTDNDVKNFWS 92
                           79******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.875143IPR017930Myb domain
PfamPF139212.6E-9149No hitNo description
SuperFamilySSF466895.47E-23191IPR009057Homeodomain-like
CDDcd001674.28E-8143No hitNo description
Gene3DG3DSA:1.10.10.601.4E-15149IPR009057Homeodomain-like
SMARTSM007170.008145IPR001005SANT/Myb domain
PROSITE profilePS5129419.924499IPR017930Myb domain
SMARTSM007171.5E-114997IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.7E-185097IPR009057Homeodomain-like
PfamPF002491.5E-115292IPR001005SANT/Myb domain
CDDcd001672.56E-105291No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
AEEDSVLLEH VRTHGPRDWS SIRSKGALQR TGKSCRLRWV NKLRPNLKTG CKFSADEERV  60
VIELQAQFGN KWARIATYLP GRTDNDVKNF WSTRQKRLAR LLRAPLRARP SKTRSSNTKA  120
SASSLESAMG SCQDHVPSVC NSSGGQSLAA APPMEYQDAA RISHDQMCSG FLSFEPLPLQ  180
AAAPATTEGE ASSSNAAYYQ LAPESSFYHH PYHLLEFPGL PERCSIDPGF VGASAMDDLA  240
YQELLPPLHP APMMMPFFGM EYSRDAIKVE TRDNFFDDLP PDVFDSFDQV PPPFSPSATN  300
SEL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-2129733126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0994154e-36AF099415.1 Zea mays clone ZmMYBIP102 R2R3MYB-domain protein mRNA, partial cds.
GenBankAL6630004e-36AL663000.4 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBb0034G17, complete sequence.
GenBankAL7316134e-36AL731613.5 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0065H10, complete sequence.
GenBankAP0149604e-36AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankCP0126124e-36CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
GenBankCR8552184e-36CR855218.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSIGBa0106P14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010240210.21e-143PREDICTED: myb-related protein MYBAS2
TrEMBLW5BXI70.0W5BXI7_WHEAT; Uncharacterized protein
STRINGBRADI5G17600.11e-143(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57003357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.17e-59MYB family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]